Dataset for protein Unclassified of organism Lottia gigantea

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|V3ZZU7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Lottia gigantea (length=232 residues).
MSTTGMDSNLYASKVSNMIVNKSLFAELSKQYRSLPGAAGLNDIGNVDECTQTPGSSSPLEQVRRDAEVIANDVVLTFGA
DETKKATNKYCKTMRRTVKEISERHDISFKGMVNKLKVEESGRTFETFVNVADEIFDDGQINWGRIVAVYAFAARLANYC
RQKDLNDCPEKVSLYAGKYVGSKLGKWILDHGGWDAFVEFFPDHGEFEEKVWKGLLFTAVGLGALATVVASR
>gnl|bcl2dbpro|V4B1H3_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Lottia gigantea (length=186 residues).
MDDELSRNIVQDYVSYRLRKNGHRWQNGPMIEGGPSRICLTMRSLADEFEDRYRSQFEDMVNQLEITPGIAYQTFRSVVS
ELFSDGVNWGRIVALFTFGGSICVQCVENNMPHVVDNVVDWVTTYCDNDLKPWIDSHNSWQGFVAFYDREPERRNDSPWT
SFRKICGFAAGAIGVLTLGAILTQKS
© 1998-2019