Dataset for protein Bfl1 of organism Lonchura striata domestica

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A218V8Z6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Lonchura striata domestica GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRTMASSLQDQTEEAVRPLLDRIDISSVAVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSRIT
ALFIALVSLFREYY
© 1998-2019