Dataset for protein Mcl-1 of organism Lepisosteus oculatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5MMB7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Lepisosteus oculatus GN=MCL-1 (length=293 residues).
MSLSSLKRTSASAVIQLYCPNATTIHPGLASLGPCPGGSAARTAVLDPMLKADYAEDELDNYSAEPVATSAWIPKSPRSL
PAGLKLGGHFPESGHADGSLPSTPDTPLDCGSVPEFLSEAHGQLNAETRELIGTFLQMYTGLPHRRSRGKALETLKRVVD
SVVAKHQIAYHGMIAKLELENKGEDVSFVTGVAKSLFSDGKTNWGRIASLVSFGAVVAKQMKDSGRESCVEAVGQAISNY
LLQDQREWLLNNRGWDGFVEFFRVEDPESTIRNALMAFAGVAGLGAGLALLIR
© 1998-2019