Dataset for protein BCL-2-like of organism Lepisosteus oculatus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|W5MG74_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lepisosteus oculatus GN=BCL2L1 (length=222 residues).
KMSYSNRDLVVYYINYKLSQKNYSWDQFSLEGRTGGAEAVGSGSPNAEERTNGAANGGGGPVSRQPPQGIEAVQGALRDS
ANEFELRYGRAFSDLSSQLHITPATAYQSFEHVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSNLVSRIAEWMTVY
LDNNIQPWIQSQGGWDRFAEIFGKDAAAEYRRSQESFKKWLLAGMTLVTGLVVGSYIAKKRL
>gnl|bcl2dbpro|W5MMB7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Lepisosteus oculatus GN=MCL-1 (length=293 residues).
MSLSSLKRTSASAVIQLYCPNATTIHPGLASLGPCPGGSAARTAVLDPMLKADYAEDELDNYSAEPVATSAWIPKSPRSL
PAGLKLGGHFPESGHADGSLPSTPDTPLDCGSVPEFLSEAHGQLNAETRELIGTFLQMYTGLPHRRSRGKALETLKRVVD
SVVAKHQIAYHGMIAKLELENKGEDVSFVTGVAKSLFSDGKTNWGRIASLVSFGAVVAKQMKDSGRESCVEAVGQAISNY
LLQDQREWLLNNRGWDGFVEFFRVEDPESTIRNALMAFAGVAGLGAGLALLIR
>gnl|bcl2dbpro|W5N4F7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Lepisosteus oculatus GN=BCL-2 (length=231 residues).
MANNEAPYDTRNIVTKYIHHKLLKKGYVWESRVSGETDPPNNGLVGPSASGPGLQARRLQAAGAERGAVPVPRRTPPPDP
HAALHKVLREAGDEIERMYHRDFAEMSDQLHFTPNTARRKFTAVVEELFRDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIANWMTEYLNGPLQNWIQENGGWDAFVELYGRQRGSMFSCSWPSLKTFFGLAALGAAGLTVGAYFTQK
© 1998-2019