Dataset for protein Bcl-xL of organism Lepisosteus oculatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5MG74_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lepisosteus oculatus GN=BCL2L1 (length=222 residues).
KMSYSNRDLVVYYINYKLSQKNYSWDQFSLEGRTGGAEAVGSGSPNAEERTNGAANGGGGPVSRQPPQGIEAVQGALRDS
ANEFELRYGRAFSDLSSQLHITPATAYQSFEHVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSNLVSRIAEWMTVY
LDNNIQPWIQSQGGWDRFAEIFGKDAAAEYRRSQESFKKWLLAGMTLVTGLVVGSYIAKKRL
© 1998-2019