Dataset for protein Bcl-2 of organism Lepisosteus oculatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5N4F7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Lepisosteus oculatus GN=BCL-2 (length=231 residues).
MANNEAPYDTRNIVTKYIHHKLLKKGYVWESRVSGETDPPNNGLVGPSASGPGLQARRLQAAGAERGAVPVPRRTPPPDP
HAALHKVLREAGDEIERMYHRDFAEMSDQLHFTPNTARRKFTAVVEELFRDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIANWMTEYLNGPLQNWIQENGGWDAFVELYGRQRGSMFSCSWPSLKTFFGLAALGAAGLTVGAYFTQK
© 1998-2019