Dataset for protein BCL-2-like of organism Larimichthys crocea

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4D6FTA2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Larimichthys crocea GN=BCL-2 (length=228 residues).
MANERNRNIVEKYICHKLSKQGYVWGFDDVRDEDAANNGSIVAPPPTLVRRCREASTGPDTESIPHLCKRLPQSDPHAAI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECVAKEEMTPQVDN
IAEWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGMAALGAASLTIGAYLTQK
© 1998-2019