Dataset for protein Unclassified of organism Labrus bergylta

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q3GJH9_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Labrus bergylta (length=189 residues).
MTSHRDFHPGEEVYCVVMVTFIEAITSRLLTSPSPSSPAAFCPHHQSEGSGQVGGALKRHACDDLARRYHGDLAANLSAL
SQQDGVEAAGLGGLTAVREELFRDGVNWGRIVAMMEVGGAVCSEAVKTGGAQQVEVIAGWMEEGLDSLQGWIDDNGGWVG
GLLFPLPPRHHQRAGDCSSVLDAPIGQFE
>gnl|bcl2dbpro|A0A3Q3GJH9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Labrus bergylta (length=194 residues).
MSALYNSRDIVEDFLRHRLQQDGRVTLPPRRHHAALRSTSTSSLTWRAVRVMTSHRDFHPDLTAVLRSACDDLARRYHGD
LAANLSALSQQDGVEAAGLGGLTAVREELFRDGVNWGRIVAMMEVGGAVCSEAVKTGGAQQVEVIAGWMEEGLDSLQGWI
DDNGGWVGGLLFPLPPRHHQRAGDCSSVLGFNYL
© 1998-2019