Dataset for protein BCL-2-like of organism Labrus bergylta

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A3Q3EZU5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L10 (length=206 residues).
MCRAQSDIAGRKMSCGLWKETLALAEDYLSLCCTSPRPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLRQCGPDP
CSGLRKVMEELVGDGHLNWGRVVSLFTFTGVLARQLQEQEDVKLGLDPVQGQKLGQGPGHCRGLAETIADYLGEEKKEWL
LENDGWEGFCEFSRSARETSQDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q3EZU5_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L10 (length=209 residues).
MCRAQSDIAGRKMSCGLWKETLALAEDYLSLCCTSPRPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLRQCGPDP
CSGLRKVMEELVGDGHLNWGRVVSLFTFTGVLARQLQEQEDVKLGLDPVQGQKLGQGPGHCRGLAETIADYLGEEKKEWL
LENDGWEGFCEFSRSARETSQDSSMKTALFAAAGVGLAGLTFLLIRVQA
>gnl|bcl2dbpro|A0A3Q3FUB6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQRNYPTYVLRSEDAGERTEGDMENSAASNGFLVNSRNRAGQSVMSSSPHTDIEAVKAALLDS
ADEFELLFTQAFSDLSSQLDITPNTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVQKDMGELVSRIAGWMTTY
LDEHISAWIESQGGWDCFVEIFGRGAVGEVRRSRETLTRWLLVGMALLMGVVVGVYIAKKH
>gnl|bcl2dbpro|A0A3Q3G1D7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Labrus bergylta GN=BCL-2 (length=229 residues).
MANECNRNIVEKYICHKLSKRGYEWGFEDEQDEDAANNGSLVAPPPTLVRRCREASSGPDRESIPHLCKRPPQSDPAYAD
IHRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECMSKQEMTSQVD
NIAEWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSAFCSSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q3G2E1_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=234 residues).
MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPATT
NLDAVKEALRDSANEFELRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3G2E1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=234 residues).
MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPATT
NLDAVKEALRDSANEFELRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3G2E1_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=234 residues).
MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPATT
NLDAVKEALRDSANEFELRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3GP42_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Labrus bergylta GN=MCL-1 (length=274 residues).
MDIINMKRAAVSVSAGVMSFMMPQNGVGKGQMHYGPEASSPQIAMGSSLASQNGNVGSNETTKRPKALVVNSGNDDIEDG
SLPCTPEPDSETEVSSCPTGGEVLESDTRQLISAFLREHTGLSKPGWNESSALSTMKRVVEDVLAKHRYAYNGMINKLSL
EDRGDDASFVSAVAKSLFADGTTNWGRIASLVAFGAAVSQYLKENGRGHCVELVGQEISTYLLSDHRDWLVKNNAWDGFV
EFFRVADPESTVRTTLMAFAGFAGIGATLALLIR
© 1998-2019