Dataset for protein Bcl-xL of organism Labrus bergylta

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3Q3FUB6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQRNYPTYVLRSEDAGERTEGDMENSAASNGFLVNSRNRAGQSVMSSSPHTDIEAVKAALLDS
ADEFELLFTQAFSDLSSQLDITPNTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVQKDMGELVSRIAGWMTTY
LDEHISAWIESQGGWDCFVEIFGRGAVGEVRRSRETLTRWLLVGMALLMGVVVGVYIAKKH
>gnl|bcl2dbpro|A0A3Q3G2E1_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=234 residues).
MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPATT
NLDAVKEALRDSANEFELRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3G2E1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=234 residues).
MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPATT
NLDAVKEALRDSANEFELRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3G2E1_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=234 residues).
MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPATT
NLDAVKEALRDSANEFELRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
© 1998-2019