Dataset for protein Unclassified of organism Kryptolebias marmoratus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2ZTM7_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Kryptolebias marmoratus (length=209 residues).
MPDSYSSHDVVEGFLCYNLLSGGMAWRFYRDVSALLPWRSEPAMVTHGGVAPGYLQQAPPRLLAALQSACHELEGRYQGD
LYAQVVALQRGEGGGAVWRWRLKTVTDELFRDGMNWGRVVVMMALGGALSREAVRTGETDQVDVIADWLEESLDSPRLRR
WMGDNGGWDAFVELYESRPAVPFWTPRTVFGLVALGAAFITLGVLLTQR
>gnl|bcl2dbpro|A0A3Q3GG85_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Kryptolebias marmoratus (length=197 residues).
MSCGLWKETLAVAEDYLSLHCPSPCPGSPPPSDTAAAAAAAMRRLGQAMEAQHQARFHSLAQNFLRHCGPDLCSGLRKVM
DEMAGDGHFNWGRVVSLFTFTGVLLRQLQEQQRGSKPGLDPGQPQELEPVSCRALAKTIADYLEEHKKDWLLENNGWEGF
CQYSRKATEASQDSSMKTALVAAAGVGLAGLTFLLVR
© 1998-2019