Dataset for protein BCL-2-like of organism Kryptolebias marmoratus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3Q3B0R2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Kryptolebias marmoratus GN=BCL-2 (length=297 residues).
MEVNRFIVENYICHKLSKRGYAWGSDRPRRVRDDAANNGSVASQSPTLVRRCRGARGAPGGAGTAPPDAESDPDPVLCGR
ISPHEPLAHIHRVLREAGDELERLYQPDFVEMSRQLGLASAAAKARFAEVMDELFRDGVNWGRIIAFFEFGGTVCVECAS
REEMTPQVDHIAEWMTEYLNGPLNSWIEDNGGWDAFVELYDRHKESVFSCYWPSIKTVFGLAALGAASITIGAYLTQKMP
LTPQRQPSDQIWLSSKPRSENCFPPPAPPCQNRHKSKQQREPEARPREQRMSEVESH
>gnl|bcl2dbpro|A0A3Q3B3X5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Kryptolebias marmoratus GN=BCL2L1 (length=232 residues).
MSQNKELVLFYIMYKLSQRNYPVNHIILSDPPNRTDAGDAGLEDAEMTETHANGTFNGTSPGTPPASPLRQQPLPTTANM
DKVKEALRDTANEFELRYARAFSDLHSQLHITPGTVYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLV
ARIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGDNAAAESRISQEGLKKWLLVGMTVVTAVVAGSLFAQKRL
>gnl|bcl2dbpro|A0A3Q3B4V7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Kryptolebias marmoratus GN=MCL-1 (length=272 residues).
MFPKPKPSYIFFLQNGVVDGLHRDTSPQVSIGASLGSENGSVASCNSSKRPKDLVMPPLKGYQDKRFQELGDDHGSLPST
PEVDGNPDVPGGAEDEVLENDTKHLISRFLQEFTGLSKRQWSESKELSTMNRVVEDLLTKHRFAYNGIIKKLSLDDKSED
MTFVTKTARSLFADGITNWGRISSLVAFGAVVAVHLKEKGREECVELVGQEISTYLLSEQKDWLLKNNSWSGFVEFFRIT
DPESTVRNTLMAVAGFAGLGATLALLISVCWP
>gnl|bcl2dbpro|A0A3Q3B4V7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Kryptolebias marmoratus GN=MCL-1 (length=348 residues).
MFPKPKPSYIFFLQNGVVDGLHRDTSPQVSIGASLGSENGSVASCNSSKRPKDLVMPPLKGYQDKRFQELGDDHGSLPST
PEVDGNPDVPGGAEDEVLENDTKHLISRFLQEFTGLSKRQWSESKELSTMNRVVEDLLTKHRFAYNGIIKKLSLDDKSED
MTFVTKTARSLFADGITNWGRISSLVAFGAVVAVHLKEKGREECVELVGQEISTYLLSEQKDWLLKNNSWSGFVEFFRIT
DPESTVRNTLMAVAGFAGLGATLALLISTWSAKCEHRPLENESCVSLAPGIRSCYLSTTTHLSWAAEIWAAGVDQQDESN
LNIGWILPLHNDCWRQAPAPCVSAGKRE
>gnl|bcl2dbpro|A0A3Q3BEB7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Kryptolebias marmoratus GN=BCL2L1 (length=218 residues).
MSHSNRDLVQFYISYKLSQRNCSKSLLMPEVAGERTEKASSAPSNGLLVNSRDGQSGKKIWPRRSDIEAVKSALKDSADE
FERLYTQSFSHLSLQLDISPDTVYHSFKSVLDELFKDGVNWGRVVGLFAFGGVLCVQCVERDMSELVSRIADWMTVYLDE
QIGPWIDSQGGWDSFAEMYGRDAAAEARRFQESLKKWLLAGAALLAGLLLGVLVAKKR
© 1998-2019