Dataset for protein Unclassified of organism Ixodes scapularis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|B7Q4U7_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ixodes scapularis (length=285 residues).
MAVNETDKTQVSEMVNDFLRYQLNRRDLQWTTCPPLPRPSKVVLVLRTLGDEFLAKYRDEFVQMCGRLDLTPSVAQTAFL
DVLNELFSEGITWSRVVGAFAFSFELSAHCVEKNWSDLVDGIASWLSSYVCTRLLPWIQDHGGWVSDPPTRIPSPRASAA
FHDAGFRRGGRRFSLSQFLLPRPTVSLPLNGGLSCRSLPPLPARSAYLGDANSPHSLKPAPVCSHTEVWADAEPPQAPKS
GARSTRRSGCDAARTLIEPKPLEKIKTAECGVHLVVPSGSFIPRD
© 1998-2019