Dataset for protein BCL-2-like of organism Ictidomys tridecemlineatus

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A287CZ07_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L1 (length=224 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAINGATGHSSSLDAREV
IPMAAVKQALREAGDEFELWYWRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGHIVAFLSFGGALCMESVDKEMQ
VLVSRIASWMPWIQENGGWDTFVELYRNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A287DCH9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=MCL-1 (length=283 residues).
MFGLKRNAVIGLNLYCGGAEVPDVTATPARRLFFAPTYCVSPPEKMEAPAAAMSPEEELDGYEPEPLGKRPAVLPLLELV
GEAAKSPGADGSLPSTPPPAEEEDDELYRQSLEIISRYLREQATGSKDAKPLRGSGAASRKALETLRRVGDGVQRNHETA
FQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLV
KQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A287DCH9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=MCL-1 (length=333 residues).
MFGLKRNAVIGLNLYCGGAGLGASGGATPPGAQLLAAEKEAAARREAGGGEAAQPPSARRVARPVPIGAEVPDVTATPAR
RLFFAPTYCVSPPEKMEAPAAAMSPEEELDGYEPEPLGKRPAVLPLLELVGEAAKSPGADGSLPSTPPPAEEEDDELYRQ
SLEIISRYLREQATGSKDAKPLRGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDG
VTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAG
VAGVGAGLAYLIR
>gnl|bcl2dbpro|I3MCZ7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2A1 (length=175 residues).
MNDCEFRFIHTLAQDYLQHVLQVPQRGSSPSKTSKVLQNVAFSVQKEVEKNLKPFLDNFDVVSADTARTIFNQVMEKEFE
DGIMNWGRIVTIFAFGGVLVKKLLRERIAPAVDSDEEISYFVAEFIMNNAGEWIRQNGGWENGFVKKFEPKSGWLTFLGV
TGQICEMLSLLKQYY
>gnl|bcl2dbpro|I3MUP5_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|I3MUP5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|I3MUP5_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|I3MVK9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL-2 (length=195 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAASPGAAPGPGIFSSQPGSHTPAARTSPPPPPAAPAAAAGPVLS
PVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWVGARRVE
>gnl|bcl2dbpro|I3ND50_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L2 (length=168 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWLFSRGNMGALIGGWDS
CAGKEAWG
>gnl|bcl2dbpro|I3ND50_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019