Dataset for protein Bcl-2 of organism Ictidomys tridecemlineatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|I3MVK9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL-2 (length=195 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAASPGAAPGPGIFSSQPGSHTPAARTSPPPPPAAPAAAAGPVLS
PVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWVGARRVE
© 1998-2019