Dataset for protein Unclassified of organism Hydra vulgaris

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A1E3K7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Hydra vulgaris (length=178 residues).
MSDTPINFNTPEAKIAKEVAYQLIQKKTGKNIKNQQIRKETELMMRLVEEIEIKHELFLSNMCKRLNLNTENAQSMFHTI
AEEIFSDGINWGRIIVLYAFAGKIAEHCRKSNDEQIIDKIALWVAGFVAKKSSWIRDSGRGWNGFIENFDVKQDSWVQGL
FAATLGLGTIAAALYIKS
>gnl|bcl2dbpro|A7LM79_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Hydra vulgaris (length=205 residues).
MTTNSFSNVLCNLETPCNKNVEPCDKKNIENTLNNEIKLSKTYIDSLLVATYVVKKRIGIQQKYNKIGEKVFELCLELVS
KHETFFNNLTNELNISRDNIKEVIKIVLRNVLKDSINFGRITSILAVCMIVSEHCYKNESMSDKVCLIVETTAEIIYENR
KWFEANGAWDGLMKYFFNPTDYFWKGFVVTTVGLGAMAGLLYAKS
>gnl|bcl2dbpro|A7LM80_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Hydra vulgaris (length=192 residues).
MAGPPNAQEDNYKRIVKSYVGEKLRKKGLKIRGYEGEELKPPVIEIAKTLQRVGDELESANTDFFKNMCDQLQITPSTAY
PTFQSIADEIFVSGKNWGRVVAFLTFGGNFAVHCALRADMGEEYVDRVVNWISKYMAVNLDYWINQQGGWDGFLIFFEKT
KNNDDEQGSQSVFLVSALAGLGVGALLMLTFK
© 1998-2019