Dataset for protein Unclassified of organism Homo sapiens

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|Q9HBF5_uncBCL2A1-02 Putative BCL2-related protein A1 protein OS=[Eukaryota] Homo sapiens (length=79 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLTKTIANTYFYF
>gnl|bcl2dbpro|Q9HBF5_uncBCL2A1-03 Putative BCL2-related protein A1 protein OS=[Eukaryota] Homo sapiens (length=79 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLTKTIANTYFYF
>gnl|bcl2dbpro|Q9HBF5_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Homo sapiens (length=79 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLTKTIANTYFYF
© 1998-2019