Dataset for protein Bcl-w of organism Homo sapiens

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q92843_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Homo sapiens GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019