Dataset for protein Unclassified of organism Hippocampus comes

[Download (right click)]

6 sequence(s)

>gnl|bcl2dbpro|A0A3Q2XQV3_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes (length=202 residues).
MDYSRRSFFFSSQRRIILHEDEQGEEDDAAAANNGLLVAPSPTLVHGSDPLADIHRVLREAGDELERLYQPDFTEMSRQL
YLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTEYLNGPLGSWIQDNGGWVSV
IRCTVVFFFSLVMKWPVAWVVLTFTALAHNFYGLTVNIQHSS
>gnl|bcl2dbpro|A0A3Q2XQV3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes (length=221 residues).
MDYSRRSFFFSSQRRIILHEDEQGEEDDAAAANNGLLVAPSPTLVLRCREASSGPERDCAPKRSHGSDPLADIHRVLREA
GDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTE
YLNGPLGSWIQDNGGWVSVIRCTVVFFFSLVMKWPVAWVVLTFTALAHNFYGLTVNIQHSS
>gnl|bcl2dbpro|A0A3Q2YEL9_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Hippocampus comes (length=200 residues).
MSSCGLWNESLAIAEDYIGLCLTADPSEAPLPPSEAAATMRRMGRHAESLYEATFQNLVQTFVRGCWPDLCSGLRRVMQE
MVSDGFLNWGRVVSVFAFTGVLARRLLEDNEEEETTTTTTKLRLDLSDWPQICRKLAETIADFLIEEKKEWMLENNGWEG
FCKWCSSSSSRQSSQDAYLKTALLAAAGVGLAGLTFLLAR
>gnl|bcl2dbpro|A0A3Q2YME0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes (length=225 residues).
MANERNRTIVENYICHKLSKRGYAWGFGAEDDAAAANNGLLVAPSPTLVLRCREASSGPERDCAPKRSHGSDPLADIHRV
LREAGDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAE
WMTEYLNGPLGSWIQDNGGWDAFVELYDRQRDSVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q2YME0_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes (length=193 residues).
MANERNRTIVENYICHKLSKRGYAWGFGAGEEDDRSHGSDPLADIHRVLREAGDELERLYQPDFTEMSRQLYLSSTTAQR
RFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTEYLNGPLGSWIQDNGGWDAFVELYDRQRD
SVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q2YX57_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hippocampus comes (length=233 residues).
MPESIRLQIFKIGLVDAFISPPKTVVQESTAPQLQEMELRSDNSDMDEGAQPLPELQTPPGQGILDSDTRRLISRFLSDF
TGLSTAAWIQSKAQSTMKRVVMRLVDKHRILFNNSINELSLDEIGLDIVSQVPQTEFANGNINWGRIASLLAFCAVLSQA
LKENQQESCVELVAQEVSTYLLSHQRTWLVQHNGWDGFAEFFKEDDLESSVRNVLLGFVGLVSITAALRCLIR
© 1998-2019