Dataset for protein Mcl-1 of organism Hippocampus comes

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2XZL8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hippocampus comes GN=MCL-1 (length=289 residues).
MSMVQPTSQVLKPQGRPMRPQNGVAEGLLQCNSPPVAAASTSPPQLHRAVATLGAVNCNSGAAKPRPSALEILCKGGLAT
MNHRNNSDDDFDVESSDDSPPSTPDSQDSLVADGRNDVVDAETKGLIRRFLTDFTGLSTASWNESKAHSTMKRVVAKVLE
KHKYKYNGIINKLSLDDRGDNVSFISEVAKSLFSDGTTNWGRVASLVAFGAIVSQHLKEKGRAHCVEPVADEISSYLLSH
QRNWLVKNNSWDGFVQFFREVDPESTVRNTLMAFAGVAGIGATLALLIR
>gnl|bcl2dbpro|A0A3Q2Y539_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hippocampus comes GN=MCL-1 (length=237 residues).
MPESKRFPLYNFKVGLVDALMLPPKAVVQGSMASQLQEVERRSDNSDMDEGAQPLPELQTPPGQGVLDTETRRLIGRFLR
DFTGLSTAAWIQSKAQSTMKRVVTRLVDKHRILFNNMVNELSLDQRGLDRSFVSQVAQTEFANGNINWGRIASLLAFCAV
LSQALKENQQERCVELVAQEVSTYLLSHQRTWLVQHNGWDGFAEFFKEDDLESTVRNGLFAFVGLVSVTAALRCLIR
© 1998-2019