Dataset for protein Bcl-xL of organism Hippocampus comes

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q3DUT7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hippocampus comes GN=BCL2L1 (length=225 residues).
MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQTPANGTTNGTSPPASPLREAASLDAVKEAL
RDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWM
TVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3DUT7_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Hippocampus comes GN=BCL2L1 (length=225 residues).
MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQTPANGTTNGTSPPASPLREAASLDAVKEAL
RDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWM
TVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3DUT7_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Hippocampus comes GN=BCL2L1 (length=225 residues).
MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQTPANGTTNGTSPPASPLREAASLDAVKEAL
RDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWM
TVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
© 1998-2019