Dataset for protein Unclassified of organism Helobdella robusta

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|T1EKX5_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Helobdella robusta (length=92 residues).
QKTFRNMIKSLDISSVNSARLSLRRVFEEVFSDRNCNWGRIVTIVAFSVEVSRFGQKLNNEDSKHFPEKISEFVSEYINE
YLSTWIVSQGGW
>gnl|bcl2dbpro|T1EKZ7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Helobdella robusta (length=71 residues).
RVLKEMFSDGHTNWGRIATLFAFGAALCKYSLENNKQELIEPITDSIALYISTNKSNWIRQQNGWVGFFLF
>gnl|bcl2dbpro|T1FMT5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Helobdella robusta (length=190 residues).
MSSLEATNKILAADYIYFKLRKSRFDWPVRCPVDLKKDGGCAEAKLAMRNLGEEFEERYRGVFNDMCQQLHITPNNASAT
FRAIIGELFSDGIRWGRIVALFSFSGCLAVECMERKMPHLVDEVLTWTTAYLDEHLSKWIQDNNGWDGFVEFSKGGQTKE
SPWPSFKTLCGYAVGALGVLTLGAILSQRS
>gnl|bcl2dbpro|T1FPP3_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Helobdella robusta (length=328 residues).
MGDIFISEENEKLLGGREDDVVAVGGNYNDDDDSISDITTTTTTTTTTTTTTTTTTTTTVATTTTIATNSINNNNAYNNG
DNNNNTNNSDSSSSTTRNRSSTHQRQNHANHQRRHRRHQTSSDDAAARDLFYLNDRFITEEFRNKCAEVAYDIVTYVCHS
GPYQPYPPPSKTTRLMRNLVNDLAKNRGELMDDMASQIVLNAKSMEQLEILLNELASEMFNDNVITWNRIVMYHAFCAYV
AKFCKLHESIEDIEEVVVRILVDIVVNRLGLWIATCGGWAQFDSQFPMLCCILQSGCIWKVLLLVCAFIGTIVIFYKAIH
FLDSSRKI
© 1998-2019