Dataset for protein Unclassified of organism Haplochromis burtoni

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q2V6F4_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Haplochromis burtoni (length=228 residues).
MASNSRDLDEMPQPRTSDRVVRPCWLNIDASGPRVIVSDGLSQSVQHLNDPPTFGSGWLADATGMIHIAGSYDTYKCVDC
NIVLSGYKKADRSLNEHVLLPTITRVARTLFSDGIINWGRIVSLVAYGTVLLQASKSTLGPECAYAIGVSIAAYITDNHM
DWLAGTDGWVCSFFTVFFRPFCLVDTFKLAWHGLRGPGMTSLGILHTQRALRSNTPKTQGGVLVGMCV
>gnl|bcl2dbpro|A0A3Q3CNF3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Haplochromis burtoni (length=198 residues).
MAAAYSSRDLVEDFLRYKLLGRGVAWPQRRANDERAPHPDPPVAPPCLQTVLRSAGDELERLYGNELSAQVTVLQLRGNG
GGAARRRHLTAIREELFRDGVNWGRIVAMMELGGALSTAAAKSGDEGQMDDIASWMEESLDSPLLRRWIHDNGGWDAFVE
LYESRPTDSFWSLRTVCGLVVLGAVGVILGFLFSQKQN
>gnl|bcl2dbpro|A0A3Q3CSD9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Haplochromis burtoni (length=226 residues).
MCQMIHWYDWQERSWHLISLALQRRSRVEMQCRNRELVEFFISYKLSQKNHPTSLLRPTNVGQRTERDLAKSLPAYDGIE
ALKSALLDSGEQFGFLFTQSFRDVASHLNITPDTAQQCFESVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMGELVP
DIADWMTAYLDDHISLWIQRNGGWDRFTEIFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
© 1998-2019