Dataset for protein BCL-2-like of organism Haplochromis burtoni

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3Q2UUP0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Haplochromis burtoni GN=BCL2L10 (length=273 residues).
MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTHSASAEGKTQLYRRSPSAVCMCREQSDIAGR
KMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKE
LVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFS
RSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q2UUP0_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Haplochromis burtoni GN=BCL2L10 (length=271 residues).
MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTHSASAEGKTQLYRRSPSAVCMCREQSDIAGR
KMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKE
LVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFS
RSAREVSQDSSMKKALFAAAGVGLAGLTFLL
>gnl|bcl2dbpro|A0A3Q2UYW8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Haplochromis burtoni GN=BCL-2 (length=228 residues).
MANEYNRNIVEKYICHKLSKRGFVWGFRVVQEEDAANNGSITDPPPTLVHRCREASTGPDGESNTHLCRRLPQSDPHAGI
HRVLREAGDELERLYQPDFTEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSSQVDN
IADWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q2VNL8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Haplochromis burtoni GN=MCL-1 (length=274 residues).
MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSPQNATGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDR
EEDGSLPSTPEFHSDSESDEQLERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVALVSQEISAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESIVRHTLMAFAGFAGIGATLALLISGL
>gnl|bcl2dbpro|A0A3Q2X557_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Haplochromis burtoni GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
© 1998-2019