Dataset for protein Unclassified of organism Gorilla gorilla gorilla

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3R922_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla (length=79 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLMKTIANTYFYF
© 1998-2019