Dataset for protein BCL-2-like of organism Gorilla gorilla gorilla

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bcl2dbpro|A0A2I2YML2_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPMLVESVAHKKRK
MAL
>gnl|bcl2dbpro|A0A2I2YML2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2I2YML2_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2A1 (length=196 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
>gnl|bcl2dbpro|A0A2I2YPX6_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L2 (length=346 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVDFKAIICSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF
YSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2I2YPX6_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2I2YQH7_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2I2YQH7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=MCL-1 (length=271 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNDTSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQECAAGFCRCCWSRSWFGISNKIALL
>gnl|bcl2dbpro|A0A2I2YQH7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNDTSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G3QES9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAVPPGAAPAPGIFSSQPGHTPHPAASRDRVARTSPLQTPAAPGA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|G3QLU6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L10 (length=204 residues).
MVDQWRERTTMADPLRERTERLLADYLGYCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVAL
MADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQ
GGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLATAFIYLWTRLL
>gnl|bcl2dbpro|G3RY91_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|G3RY91_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2019