Dataset for protein Bfl1 of organism Gorilla gorilla gorilla

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2I2YML2_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPMLVESVAHKKRK
MAL
>gnl|bcl2dbpro|A0A2I2YML2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2I2YML2_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2A1 (length=196 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
© 1998-2019