Dataset for protein Bcl-2 of organism Gorilla gorilla gorilla

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3QES9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAVPPGAAPAPGIFSSQPGHTPHPAASRDRVARTSPLQTPAAPGA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2019