Dataset for protein BCL-2-like of organism Gopherus agassizii

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A452I9V7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Gopherus agassizii GN=BCL-2 (length=220 residues).
MYLTACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSPNLSPPTVTGTSSDHAGLMSL
PPEPPGSAAASNVPLGDGLRPAPQAVLLALCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRI
VAFFEFGGVMCVESVNREMSPLVDSIAVWMTEYLNRHLHNWIQDNGGWVCVQYFFLFKLQ
>gnl|bcl2dbpro|A0A452ILL8_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Gopherus agassizii GN=BCL2L1 (length=229 residues).
MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTDSAEEAEMASVPNGSPSWHPGASHIVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A452ILL8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gopherus agassizii GN=BCL2L1 (length=229 residues).
MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTDSAEEAEMASVPNGSPSWHPGASHIVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A452J3N6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Gopherus agassizii GN=BCL2A1 (length=175 residues).
MESSEYCYVYYLVQDYLKYVLQEPQLGPAPSRVAHVLRHAASFLQKENEESLKPCLDTFDITSVDAARRIFTQVMDKEFA
DGNTNWGRILTIFMFGGILSKKLQEHRVQLTGENKKQISYFITEYIINTKAEWIEANGGWENGFLTMFEEKRSWLSLFNI
KAKIMDAFSFFSQYY
© 1998-2019