Dataset for protein Unclassified of organism Geodia cydonium

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q967D2_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Geodia cydonium (length=235 residues).
MAARGSAAPGGRANGRFHSRLYLQNTAVMEELYRRNLSEDLVRDNGLSCGGREYWREPASTVGAASDGLSEEERRTAADA
AERMTAVIAGTPGIAVERNVRDFRRGGWDVTPDNVESEFREVERRTFSDGVHWGRVIAFLAFSMSFAAYVNSRGIDGGAY
SVFNWTLRVLNDSLADFIQRENGWRGFIVYADTLLRAQGSTPPQHQTRGVWDAVAGIGVIGVGTLLALGMRQAFS
© 1998-2019