Dataset for protein Unclassified of organism Gasterosteus aculeatus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|G3PJ83_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Gasterosteus aculeatus (length=182 residues).
MSNECNRHIVEKYICHKLSKRGYAFGFDDVGEEDAASNGSMVVPPPTAVRRCREAGPDGESFPRLCKRLPQSDPTAAATH
RVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCAECVAKEEMASQVDNI
AEWMTEYLNGPLNIWIQDNGGW
>gnl|bcl2dbpro|G3PW08_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Gasterosteus aculeatus (length=200 residues).
QSDIAGRKMSCGLWKETLALAEDYLYLCCSSPRPAPPPPSGSAAAMRLLAWDMETQHQARFHALAQTFLRQCGPDPCSSL
RQVMEELVGDGHLNWGRVVSLFAFTGVLARQLLEQKATKLGLDPGQELGQEPGSCRGLAETIADYLGEEKKDWLLENDGW
EGFCKFSRSAREVGHDSSMKKALFAAAGVGLAGLTFLLVR
© 1998-2019