Dataset for protein BCL-2-like of organism Gasterosteus aculeatus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|G3NJY1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gasterosteus aculeatus GN=BCL2L1 (length=190 residues).
MSQNRELVVFYINYKLSQRNLPLNHIGLSEPPNRTGGGVEAGAAGGQRGATHSNGTFNGTSPGTPPASPLLQQRSPSTAS
LDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFEDVMDEVFRDGVNWGRIVGLFAFGGALCVECVDKEMSPL
VGRIVEWMTLYLDNHIQPWIQNQGGWRSDI
>gnl|bcl2dbpro|G3P7B4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gasterosteus aculeatus GN=BCL2L1 (length=220 residues).
MANINRELVEFFLSYKLSQKNHPTSLLRPEDAGGRTEGDKANSASVPGRGSSAGQPGMSSPPPPPSGDTEAVKAALQDSA
NEFELLFTQAFSDLSLQLDVTPDTAYHSFKSVMDEVFKDGVNWGRVVGLFAFGGVLCVECVEKDMTELVSRIADWMTTYL
DEHISAWIQSQGGWDCFADIFGRDGAAAARRSQETMRRWLLVGVALLMGVLVGMVMVKKR
>gnl|bcl2dbpro|G3PJT0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gasterosteus aculeatus GN=MCL-1 (length=319 residues).
MNIIQRPKLAALNMTGVMSCIILPQNGVAPMRQLAMGSAKDSHNGNAGTNDTPKRPSALGVNSANGYPSKPQREDSEDTD
NDSLPCTPESDSETDVSDSPAGAAALESDTRQLLGRFLREFTGLSKTQWNPSRELTTMKRVVGDVLEKHRYVFNGMVNKL
SLDDRGDDASFVREVATSLFADGTTNWGRIASLVAFGAVVCQHLAERGRGNCVELVGQEISAYLLSDQRDWLIKNNAWVG
FVEFFRVADPESAVRNTLMAVAGFASIGATLALLISGPSKVQRQLLTIELLQIVRSQRGGHRLQRDVSTRPSPTSGSGL
© 1998-2019