Dataset for protein Mcl-1 of organism Gadus morhua

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|D2ITA0_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gadus morhua GN=MCL-1 (length=277 residues).
MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLMATFKSGDERKPRPTELGRGRLVNKSQDDQE
GNGSLPSTPELQSEVDTDSQAGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKHQYAYKGMIQK
LELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAALCQYLEARGKEGCVSLVAEEISSYLLSDQREWLVKNNSWE
GFVEFFRVSDPETTVRNTLMAFAGFAGIGATIALLIR
>gnl|bcl2dbpro|D2ITA0_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gadus morhua GN=MCL-1 (length=277 residues).
MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLMATFKSGDERKPRPTELGRGRLVNKSQDDQE
GNGSLPSTPELQSEVDTDSQAGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKHQYAYKGMIQK
LELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAALCQYLEARGKEGCVSLVAEEISSYLLSDQREWLVKNNSWE
GFVEFFRVSDPETTVRNTLMAFAGFAGIGATIALLIR
© 1998-2019