Dataset for protein Bcl2l10 of organism Gadus morhua

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|D2IT42_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Gadus morhua GN=BCL2L10 (length=195 residues).
MSCRLWKETLALSEDYLLSCTASTGTAPPPPSESAAAMRGLAQDMERQHYARFQALAQSFLAQCEADACAGLRKVMEELV
GDGQLNWGRVVSLFTFTGVLARQLQEKKGVQLGQDPGTGRALGQVPGGSCRGLAETIADYLGEEKRDWLLENGGWEGFCK
FSRIAREVNQESSMKTALFAAAGVGIAGLTFLLVR
© 1998-2019