Dataset for protein Bcl-xL of organism Gadus morhua

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|D2ITA2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Gadus morhua GN=BCL2L1 (length=227 residues).
MSIDTSMSISNRELVFFFLSHKLSQRNYRPIPFQPEGAGEGTDEDKSNRIGNNGLRLNDGNGNGQLAPSPTPQGTEAVRA
ALLESVEEFELRYTLAFSDLSSQLPITPATAYGSFESVMDEVFRDSINWGRIVGLFAFGGALCVECVEKEMSHMVPRVAE
WMTRYLDDHIDHWIQSNGGWKHFAAVFGSDAAAGARRTRDSHRRWMLVGAALLTGVLLGALLAKKHV
© 1998-2019