Dataset for protein BCL-2-like of organism Fundulus heteroclitus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3Q2NRP4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Fundulus heteroclitus GN=BCL2L1 (length=219 residues).
MSYSNRELVEFYISYKLSQTNCPNSLLRSEVAGDRTEGDKDSPASSNGPLVSSWAGSPWQPWAPHGRAEAVKSALRDSAD
EFEHLFTQSFSHLSLQLDITPDTAYHSFKAVLDELFKDGVNWGRVVGLFAFGGVLCVDCVQKNMSELVPRIADWMTIYLD
EQLDPWVRSQGGWECFAKLYGQDAAAAGRRFQETLNKWLLVGAALLTGFLLVVLFAKKR
>gnl|bcl2dbpro|A0A3Q2PJS5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Fundulus heteroclitus GN=BCL2L10 (length=202 residues).
MCREPSHIAGRKMSCGLWKETVAVAEDYMRLRCSSPHPAPPPPSEPAAAMRRLAQDVESQHQARFHALAQSFLRHSQTDL
CTSLWKVMDEMVGDGHFNWGRVVSLFTFAGVLARQLQEQQGRSPGPDPGRQQEPVSCRELAETIADYLEKHKKDWLQEND
GWDGFCNYAHGARGASQDSSMKTALVAVAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q2PN77_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Fundulus heteroclitus GN=BCL-2 (length=230 residues).
MANDCNRDIVENYIFHKLSKRGYAWRFDGVRDDDAAANGGLGDRSPTLVRRCRDAAAPGQDSDGDPRRVRGRLSQSDPHA
DIHRVLREAGDELERLYQLDFAEMSQQLYITRDTARTRFAEVVDELFRDGVNWGRIIAFFEFGGTVCVECASKEGMSSQV
DNIAEWMTEYLNGPLGSWIQDNGGWDAFVELYDRQKESIFSCYWPSIKTVFGLAALGAASITIGAYLAQK
>gnl|bcl2dbpro|A0A3Q2QPL9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Fundulus heteroclitus GN=BCL2L1 (length=229 residues).
MSQNRELVLSYVKFKLSQRNYPVNHIMLNEPPSDGGARDAESDEEQTAETHANGTVNGTSSGSPRRRQQQPASTAAMEAV
KVALRETACEFELRYARAFNDLHSTLHITPATAYQSFENVMNEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDEQIDPWIQSQGGWERFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFVQKRL
>gnl|bcl2dbpro|A0A3Q2T2A9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Fundulus heteroclitus GN=MCL-1 (length=272 residues).
MSKAPTSTQLVNCLISQNGVGDGQPHYRPGLQLPEVEMSSSSEDLRWDCSKRPKNLRVMARNGFAVKSIQENRDDGSLPS
TPEMQADSEAAGCGSHAGQEALDSDTTELISGFLRDFTGLSGHRWYTKKSLSTMKRVVEDLLSKHRYAYTGMIRKLNLDQ
KSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQHLKESGRSHCVDLVSREISTYLLTNQRDWLAKNNSWDGFVEF
FKVEDTESTVRNTLMAFVGVAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A3Q2T2A9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Fundulus heteroclitus GN=MCL-1 (length=297 residues).
MSKAPTSTQLVNCLISQNGVGDGQPHYRPGLQLPEVEMSSSSEDLRWDCSKRPKNLRVMARNGFAVKSIQENRDDGSLPS
TPEMQADSEAAGCGSHAGQEALDSDTTELISGFLRDFTGLSGHRWYTKKSLSTMKRVVEDLLSKHRYAYTGMIRKLNLDQ
KSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQHLKESGRSHCVDLVSREISTYLLTNQRDWLAKNNSWDGFVEF
FKVEDTESTVRNTLMAFVGVAGIGAGLAFLIRNSIKISFIGQDCSWAFTSPPTFPGL
© 1998-2019