Dataset for protein Mcl-1 of organism Ficedula albicollis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|U3KKY6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ficedula albicollis GN=MCL-1 (length=91 residues).
KKNKKNLPGMLRKLEIQQEEDLQSVVEVAAHVFSDGVTNWGRVVTLIAFGAFVAKHLKSIKQEQSITSLAGIITDALVSS
KRQWLESQGGW
© 1998-2019