Dataset for protein Bcl-2 of organism Ficedula albicollis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|U3KEW4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ficedula albicollis GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAAVAAAAGTSSDHTGPVSPHPEPPGSAAASPA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
© 1998-2019