Dataset for protein Mcl-1 of organism Felis catus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|M3XAP4_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Felis catus GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNENDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|M3XAP4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Felis catus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSL
PSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|M3XAP4_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Felis catus GN=MCL-1 (length=270 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSL
PSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQKCAAGFCRCCWSRSWFGISNKIAF
>gnl|bcl2dbpro|Q7YRZ9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Felis catus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPKLLFFAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSL
PSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2019