Dataset for protein Bcl-w of organism Felis catus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2I2UAE3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Felis catus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019