Dataset for protein Bcl-xL of organism Felis catus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|M3XA94_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Felis catus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q8SQ42_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Felis catus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERSNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2019