Dataset for protein Bcl-2 of organism Felis catus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|M3X1R9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Felis catus GN=BCL-2 (length=237 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAAA
GPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
NREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
© 1998-2019