Dataset for protein Unclassified of organism Felis catus gammaherpesvirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0M4MPT9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Viruses] Felis catus gammaherpesvirus 1 (length=189 residues).
MEQNQDEHADVLAAFIGEFYGFYGLPFSGDFGSTECHVVGLVLADVAYQATTQLQGFEHLFQQMLQMDLDEAVILFQEVA
QELFTEINCGRIIIFLSFSGLLLVKCVTQRKILLERCLHTSILTLLRGVLGNWLEQNGGYDALLNNLVQNHPLVDLTTSP
SYRFLTYFFIFLCGAAVAALFSILLMKIR
© 1998-2019