Dataset for protein Unclassified of organism Esox lucius

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A3P8ZG74_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius (length=148 residues).
MMMTYVRCLLSPNLGFVNEWPVDTLNCLDGISKGDGCFCGVCGLWCSGSKALSTMKQVVTKSLDKHRYSYNDTQRGMRFG
SVVANTDRVVSLLAFGAVGQEISIYLLTDQKDWLVKNNSWDRFIEFFRLAEESTLRNVLITFDLYNVK
>gnl|bcl2dbpro|A0A3P8ZH18_uncBCL2L10-02 Putative BCL2-like 10 protein OS=[Eukaryota] Esox lucius (length=222 residues).
MPLMTAALLLPAVRRESSLIAGRIMSCGLWKETLAVAEDYLSVCRIVPTPGSPAATPPPPPSESAAAMRHLALDMEAQHR
ARFHALAHSFLSQCGLDPCASLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRKLQGEDTDQGTGVRGTEWLGGKESCRAL
AETIANYLGKEKSDWMLKNQGWEGFCKFFHSARVVNQDSSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A3P8ZH18_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Esox lucius (length=292 residues).
MPLMTAALLLPAVRRESSLIAGRIMSCGLWKETLAVAEDYLSVCRIVPTPGSPAATPPPPPSESAAAMRHLALDMEAQHR
ARFHALAHSFLSQCGLDPCASLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRKLQGEDTDQGTGVRGTEWLGGKESCRAL
AETIANYLGKEKSDWMLKNQGWEGFCKFFHSARVVNQDSSMKTALFAAAGVGIAGNLLRRPWVPVTVASGTFCLMADARS
WKRDRYPHPPLRPQQTHTQCYTGCRYVCKINNFALDYSISYILYVHAFIYFF
© 1998-2019