Dataset for protein BCL-2-like of organism Esox lucius

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A3P8XFS0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Esox lucius GN=BCL2L1 (length=208 residues).
MSYSNRELVVFFINYKLSQRNYSCCELELEGASGRTEGEEATANGSVGNGRNSRRNLGKPSTPQGCMEAVKAALRDSADE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSLLVARIADWMTTYLDE
HIQPWIQIQGGWDRFADIFGRDAAADIRRSQESLRKWLLFGMENAQWT
>gnl|bcl2dbpro|A0A3P8XFS0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Esox lucius GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFINYKLSQRNYSCCELELEGASGRTEGEEATANGSVGNGRNSRRNLGKPSTPQGCMEAVKAALRDSADE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSLLVARIADWMTTYLDE
HIQPWIQIQGGWDRFADIFGRDAAADIRRSQESLRKWLLFGVMLLSGVLVGTLLMKKRQ
>gnl|bcl2dbpro|A0A3P8XYL5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Esox lucius GN=BCL2L1 (length=230 residues).
MTYNNKELVAYYITYKLSQRNYPINHTGLTGAFDRTEGGEVEEVAAVTMHPNGTMNGTSPGTPTQQSPPSSPRRTVGLDA
VKEALRDSANEFELRYALAFSDLSSQLHLTPATAYQSFASVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGR
IADWMTVYLDNHIQPWIESQGGWDRFAEIFGKDAAANSRKSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3P8Y1W8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=287 residues).
MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTGPLCPAASSKSKMDVDLGNGTADTPVRPTKLEVNMTKPNVLDS
RLSDLADDSDDSLPCTPLMVTECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLSQPRWKQNKSLVTMKRVVGDVIAKH
TYAYKGMISKLCLDDQGDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVVSQHLKEMGKGNCVELVGQEISTYLLTDQR
AWLVKNNAWDGFVEFFHVEDPESSVRNTLMAFAGVAGIGATLALLIR
>gnl|bcl2dbpro|A0A3P8Y1W8_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=273 residues).
MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTGPLCPAASSKSKMDVDLGNGTADTPVRPTKLEVNMTKPNVLDS
RLSDLADDSDDSLPCTPLMVTECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLSQPRWKQNKSLVTMKRVVGDVIAKH
TYAYKGMISKLCLDDQGDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVVSQHLKEMGKGNCVELVGQEISTYLLTDQR
AWLVKNNAWDGFVEFFHVEDPESSPIGLFLQVF
>gnl|bcl2dbpro|A0A3P8YNB4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Esox lucius GN=BCL-2 (length=225 residues).
MADDDNRFIVEKYICHKLLKRGYAWDFEDAEEEDGANNGSMISPPPGLVRRIHGASKAGQGSVPHISKWLSQPDPHAAIH
RVLREAGDELERLYQPDFLEMSHQLYLTSSVAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHIA
GWMTEYLNGPLHSWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3P9AAB2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Esox lucius GN=BCL-2 (length=229 residues).
MANENPYDSRVIVENYIYDKLLKNGFVWEFQTENQSRNNVFEDPSPPNSPELFARRLQPPAAGEDNDPQFANRIPQPDPH
ARLHRVLRDAGNEIERMYQRDFAEMSGQLHITPSTAHGRFTAVIDELFSDGVNWGRIVAFLEFGGTMCVESVNREMTPQV
NNIVHWMTEYLNGPLQNWIQENGGWDAFVEIYGQKRGSLFHSWPFLKTMFSLAALGAAGVTIGAMFTQK
© 1998-2019