Dataset for protein Bcl-xL of organism Esox lucius

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3P8XFS0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Esox lucius GN=BCL2L1 (length=208 residues).
MSYSNRELVVFFINYKLSQRNYSCCELELEGASGRTEGEEATANGSVGNGRNSRRNLGKPSTPQGCMEAVKAALRDSADE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSLLVARIADWMTTYLDE
HIQPWIQIQGGWDRFADIFGRDAAADIRRSQESLRKWLLFGMENAQWT
>gnl|bcl2dbpro|A0A3P8XFS0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Esox lucius GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFINYKLSQRNYSCCELELEGASGRTEGEEATANGSVGNGRNSRRNLGKPSTPQGCMEAVKAALRDSADE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSLLVARIADWMTTYLDE
HIQPWIQIQGGWDRFADIFGRDAAADIRRSQESLRKWLLFGVMLLSGVLVGTLLMKKRQ
>gnl|bcl2dbpro|A0A3P8XYL5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Esox lucius GN=BCL2L1 (length=230 residues).
MTYNNKELVAYYITYKLSQRNYPINHTGLTGAFDRTEGGEVEEVAAVTMHPNGTMNGTSPGTPTQQSPPSSPRRTVGLDA
VKEALRDSANEFELRYALAFSDLSSQLHLTPATAYQSFASVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGR
IADWMTVYLDNHIQPWIESQGGWDRFAEIFGKDAAANSRKSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
© 1998-2019