Dataset for protein Bcl-2 of organism Esox lucius

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3P8YNB4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Esox lucius GN=BCL-2 (length=225 residues).
MADDDNRFIVEKYICHKLLKRGYAWDFEDAEEEDGANNGSMISPPPGLVRRIHGASKAGQGSVPHISKWLSQPDPHAAIH
RVLREAGDELERLYQPDFLEMSHQLYLTSSVAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHIA
GWMTEYLNGPLHSWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3P9AAB2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Esox lucius GN=BCL-2 (length=229 residues).
MANENPYDSRVIVENYIYDKLLKNGFVWEFQTENQSRNNVFEDPSPPNSPELFARRLQPPAAGEDNDPQFANRIPQPDPH
ARLHRVLRDAGNEIERMYQRDFAEMSGQLHITPSTAHGRFTAVIDELFSDGVNWGRIVAFLEFGGTMCVESVNREMTPQV
NNIVHWMTEYLNGPLQNWIQENGGWDAFVEIYGQKRGSLFHSWPFLKTMFSLAALGAAGVTIGAMFTQK
© 1998-2019