Dataset for protein BCL-2-like of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A3Q2HRY3_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Equus caballus GN=BCL-2 (length=285 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPLGATPVPGIFSSQPGRTPAPARTSPLLPPAAPAGAAGPALS
PVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWQLCQAPTGSQEMFSGGWTIHSGSPLQNLCVSRAGNWFSEKKNMTWCLTSDKD
VIDRTPIRMYQGRKSREAEIQSQCRPPCMLLHLLEIQVPVLFLSE
>gnl|bcl2dbpro|A0A3Q2HRY3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Equus caballus GN=BCL-2 (length=232 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPLGATPVPGIFSSQPGRTPAPARTSPLLPPAAPAGAAGPALS
PVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|F6PH48_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Equus caballus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|F6WQI0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Equus caballus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPTGNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|F6WQI0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Equus caballus GN=BCL2L1 (length=245 residues).
MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPTGNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWKETALGTFCYFVSSLMRLSGQGGALQLAPSYSAFWADSRAPLGTRGFSLALQ
EMPLQ
>gnl|bcl2dbpro|F6ZPD4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Equus caballus GN=BCL2L10 (length=184 residues).
VAEALRERTALLLIDYLQRRAREPATPEVAVLRCVAAQIQPRNQRVLSRYRGFRGDHVGLAARMAQAIFGDRHVPSWGRV
AALVTLAGTLLERAPRGTYRKPKRGYKLELREWKAGVDRDWLRAWWTSCAHGSRGGTAPGWRLTMDGFCDFSLTLPASQR
ILLVRFLLSCFSASVLIYLWTKLS
>gnl|bcl2dbpro|F7AVA6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Equus caballus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGGGGASSPGGRLLAAGKEATARREGGGGEAGAVIGGSAGGSPQTTLAPDSLRVARPS
PIGAEGPDVTAPSSRLLFFAPTRCASPPEGMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLEFVREASSGPCTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDTKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMAHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|F7CP56_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus GN=BCL2A1 (length=174 residues).
MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFE
DGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWENGFVKKFEPKSGWLTFLEV
TGKMCEILFLKQYY
© 1998-2019