Dataset for protein BCL-2-like of organism Dipodomys ordii

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A1S3EPX7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Dipodomys ordii GN=BCL2L1 (length=234 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEESRTEDPEGTESEMETPSAINGNPSWHLADSPAVVNGATGHSSSSEARE
VIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEM
QVLVSRIASWMATYLNDHLEPWIQEHGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A1S3F3I1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Dipodomys ordii GN=MCL-1 (length=349 residues).
MFGLRRNAVIGLNFYCGGAGLGAGSGAAAAPGGRLLTAEEASARREAGGGEAGAGIGGSAGASPSTTLAPDARRVARPAP
IGAEVPDVTGTPTKRVFFAPTHRAPTPDEMEAAAAGAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASKSSRTDGSLP
STPPPAEEEDDELYRQSLEIICRYLREQATGAKDAKPLGGAGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
EDLEGSIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A1S3FYD8_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Dipodomys ordii GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019