Dataset for protein BCL-2-like of organism Dicentrarchus labrax

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A1X9JZA1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Dicentrarchus labrax GN=BCL-2 (length=228 residues).
MANECNRNIVEKYICHKLSKQGYEWGFDAVRNADAGNNGSIVAPPPSLVRRCRGASTGPDSESIPHLCTRLPQSDPHAAI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFADVIDELFRDGVNWGRIIAFFEFGGTVCVECVAKEEMAAQVNN
IAEWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGVAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|E6ZFR0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Dicentrarchus labrax GN=BCL2L1 (length=220 residues).
MSYSNRELVEFFISYKLSQRNHPTSLLRPENAGERTEGDKANSAARNGLLASKNTSGQPGTSSSSGADIEAVKAALRDSA
DEFELLFTQAFSDLSSQIDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKDMSELVSRIADWMTMYL
DEHISPWIQSQGGWDCFAEVFGRDAAAEARRSRETLSRWLLIGVALLMGAVVGVLIAKKH
© 1998-2019